Recombinant Full Length Human GAP43 Protein, GST-tagged

• Cat.No.: GAP43-5416HF
• Product Overview: Human GAP43 full-length ORF ( AAH07936, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene has been termed a growth or plasticity protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 51.92 kDa
• Protein length: 238 amino acids
• AA Sequence: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GAP43 growth associated protein 43 [ Homo sapiens ]
• Official Symbol: GAP43
• Synonyms: GAP43; growth associated protein 43; neuromodulin; axonal membrane protein GAP 43; B 50; calmodulin binding protein P 57; nerve growth related peptide GAP43; neural phosphoprotein B 50; neuron growth associated protein 43; PP46; protein F1; neural phosphoprotein B-50; growth-associated protein 43; axonal membrane protein GAP-43; calmodulin-binding protein P-57; nerve growth-related peptide GAP43; neuron growth-associated protein 43; B-50
• Gene ID: 2596
• mRNA Refseq: NM_001130064
• Protein Refseq: NP_001123536
• MIM: 162060
• UniProt ID: P17677