Recombinant Full Length Human Gap Junction Alpha-10 Protein(Gja10) Protein, His-Tagged
Cat.No. : | RFL18970HF |
Product Overview : | Recombinant Full Length Human Gap junction alpha-10 protein(GJA10) Protein (Q969M2) (1-543aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-543) |
Form : | Lyophilized powder |
AA Sequence : | MGDWNLLGGILEEVHSHSTIVGKIWLTILFIFRMLVLRVAAEDVWDDEQSAFACNTRQPG CNNICYDDAFPISLIRFWVLQIIFVSSPSLVYMGHALYRLRAFEKDRQRKKSHLRAQMEN PDLDLEEQQRIDRELRRLEEQKRIHKVPLKGCLLRTYVLHILTRSVLEVGFMIGQYILYG FQMHPLYKCTQPPCPNAVDCFVSRPTEKTIFMLFMHSIAAISLLLNILEIFHLGIRKIMR TLYKKSSSEGIEDETGPPFHLKKYSVAQQCMICSSLPERISPLQANNQQQVIRVNVPKSK TMWQIPQPRQLEVDPSNGKKDWSEKDQHSGQLHVHSPCPWAGSAGNQHLGQQSDHSSFGL QNTMSQSWLGTTTAPRNCPSFAVGTWEQSQDPEPSGEPLTDLHSHCRDSEGSMRESGVWI DRSRPGSRKASFLSRLLSEKRHLHSDSGSSGSRNSSCLDFPHWENSPSPLPSVTGHRTSM VRQAALPIMELSQELFHSGCFLFPFFLPGVCMYVCVDREADGGGDYLWRDKIIHSIHSVK FNS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GJA10 |
Synonyms | GJA10; CX62; Gap junction alpha-10 protein; Connexin-62; Cx62 |
UniProt ID | Q969M2 |
◆ Recombinant Proteins | ||
Casp12-779M | Recombinant Mouse Casp12 protein, His & GST-tagged | +Inquiry |
AL529-RS01370-5899S | Recombinant Staphylococcus capitis (strain: FDAARGOS_173, nat-host: Homo sapiens, culture-collection: FDA:FDAARGOS_173) AL529_RS01370 protein, His-tagged | +Inquiry |
CMTM3-1862HF | Recombinant Full Length Human CMTM3 Protein, GST-tagged | +Inquiry |
META-1991B | Recombinant Bacillus subtilis META protein, His-tagged | +Inquiry |
TNFa-24S | Recombinant Swine TNF alpha | +Inquiry |
◆ Native Proteins | ||
PIV1-18 | Native Parainfluenza Virus Type 1 Antigen | +Inquiry |
COL2A1-15C | Native Chicken COL2A1 Protein | +Inquiry |
PLG -37D | Native Canine plasminogen | +Inquiry |
ALPL-8004H | Native Human Liver Alkaline Phosphatase | +Inquiry |
LTF-27590TH | Native Human LTF | +Inquiry |
◆ Cell & Tissue Lysates | ||
MICALL1-1111HCL | Recombinant Human MICALL1 cell lysate | +Inquiry |
TWF1-633HCL | Recombinant Human TWF1 293 Cell Lysate | +Inquiry |
LRRIQ3-1031HCL | Recombinant Human LRRIQ3 cell lysate | +Inquiry |
FUCA2-6122HCL | Recombinant Human FUCA2 293 Cell Lysate | +Inquiry |
FUCA1-1212HCL | Recombinant Human FUCA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GJA10 Products
Required fields are marked with *
My Review for All GJA10 Products
Required fields are marked with *
0
Inquiry Basket