Recombinant Full Length Human GALNT13 Protein, GST-tagged

Cat.No. : GALNT13-5197HF
Product Overview : Human GALNT13 full-length ORF ( NP_443149.1, 1 a.a. - 556 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 556 amino acids
Description : The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT; EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins (see MUC3A, MIM 158371) by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.[supplied by OMIM
Molecular Mass : 90.4 kDa
AA Sequence : MRRSVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMTLGT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GALNT13 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13) [ Homo sapiens ]
Official Symbol GALNT13
Synonyms GALNT13; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13); polypeptide N-acetylgalactosaminyltransferase 13; GalNAc T13; KIAA1918; UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 13; pp-GaNTase 13; GalNAc transferase 13; polypeptide GalNAc transferase 13; protein-UDP acetylgalactosaminyltransferase 13; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13; GalNAc-T13; FLJ16031; FLJ41157; H_NH0187G20.1; MGC119459; MGC119461; WUGSC:H_NH0187G20.1;
Gene ID 114805
mRNA Refseq NM_052917
Protein Refseq NP_443149
MIM 608369
UniProt ID Q8IUC8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GALNT13 Products

Required fields are marked with *

My Review for All GALNT13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon