Recombinant Full Length Human GALNT1 Protein

• Cat.No.: GALNT1-179HF
• Product Overview: Recombinant full length Human GALNT1, isoform 2 with N terminal proprietary tag. Predicted MW 37.62 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• ProteinLength: 105 amino acids
• Description: This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature.
• Form: Liquid
• Molecular Mass: 37.620kDa inclusive of tags
• AA Sequence: MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKER GLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFK INQFNLMASEMIALNRSLPDVRLEG
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: GALNT1 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1) [ Homo sapiens ]
• Official Symbol: GALNT1
• Synonyms: GALNT1; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1); polypeptide N-acetylgalactosaminyltransferase 1; GalNAc T1; protein UDP acetylgalactosaminyltransferase 1
• Gene ID: 2589
• mRNA Refseq: NM_020474
• Protein Refseq: NP_065207
• MIM: 602273
• UniProt ID: Q10472