Recombinant Full Length Human GADD45A Protein, GST-tagged

• Cat.No.: GADD45A-5206HF
• Product Overview: Human GADD45A full-length ORF ( AAH11757.1, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 44.7 kDa
• Protein length: 165 amino acids
• AA Sequence: MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GADD45A growth arrest and DNA-damage-inducible, alpha [ Homo sapiens ]
• Official Symbol: GADD45A
• Synonyms: GADD45A; growth arrest and DNA-damage-inducible, alpha; DDIT1; growth arrest and DNA damage-inducible protein GADD45 alpha; GADD45; DDIT-1; DNA damage-inducible transcript-1; DNA-damage-inducible transcript 1; DNA damage-inducible transcript 1 protein; growth arrest and DNA-damage-inducible 45 alpha
• Gene ID: 1647
• mRNA Refseq: NM_001199741
• Protein Refseq: NP_001186670
• MIM: 126335
• UniProt ID: P24522