Recombinant Full Length Human GADD45A Protein, GST-tagged

Cat.No. : GADD45A-5206HF
Product Overview : Human GADD45A full-length ORF ( AAH11757.1, 1 a.a. - 165 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 165 amino acids
Description : This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. [provided by RefSeq
Molecular Mass : 44.7 kDa
AA Sequence : MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GADD45A growth arrest and DNA-damage-inducible, alpha [ Homo sapiens ]
Official Symbol GADD45A
Synonyms GADD45A; growth arrest and DNA-damage-inducible, alpha; DDIT1; growth arrest and DNA damage-inducible protein GADD45 alpha; GADD45; DDIT-1; DNA damage-inducible transcript-1; DNA-damage-inducible transcript 1; DNA damage-inducible transcript 1 protein; growth arrest and DNA-damage-inducible 45 alpha;
Gene ID 1647
mRNA Refseq NM_001199741
Protein Refseq NP_001186670
MIM 126335
UniProt ID P24522

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GADD45A Products

Required fields are marked with *

My Review for All GADD45A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon