Recombinant Full Length Human G Protein-Activated Inward Rectifier Potassium Channel 1(Kcnj3) Protein, His-Tagged
Cat.No. : | RFL31222HF |
Product Overview : | Recombinant Full Length Human G protein-activated inward rectifier potassium channel 1(KCNJ3) Protein (P48549) (1-501aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-501) |
Form : | Lyophilized powder |
AA Sequence : | MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQDPQQQLVPKKKRQRFVDKNGRCNVQHGNL GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEIVVILE GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDITTKLPSKLQKITGREDFPKKLLRMS STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG AARMEGNLPAKLRKMNSDRFT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNJ3 |
Synonyms | KCNJ3; GIRK1; G protein-activated inward rectifier potassium channel 1; GIRK-1; Inward rectifier K(+ channel Kir3.1; Potassium channel, inwardly rectifying subfamily J member 3 |
UniProt ID | P48549 |
◆ Recombinant Proteins | ||
HIST1H1T-23P | Recombinant Pig HIST1H1T protein, His-tagged | +Inquiry |
RAPK-2436B | Recombinant Bacillus subtilis RAPK protein, His-tagged | +Inquiry |
OLFR867-12036M | Recombinant Mouse OLFR867 Protein | +Inquiry |
RPAP2-14391M | Recombinant Mouse RPAP2 Protein | +Inquiry |
ZFYVE21-1628H | Recombinant Human ZFYVE21 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
C6-101H | Native Human C6 Protein | +Inquiry |
ALB-124P | Native Porcine serum albumin | +Inquiry |
REN-388H | Active Native Human Renin Antigen | +Inquiry |
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
CA2-32S | Native Sheep Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEPT6-1955HCL | Recombinant Human SEPT6 293 Cell Lysate | +Inquiry |
KRTAP10-7-4857HCL | Recombinant Human KRTAP10 293 Cell Lysate | +Inquiry |
CTSV-2559HCL | Recombinant Human CTSV cell lysate | +Inquiry |
C11orf52-8345HCL | Recombinant Human C11orf52 293 Cell Lysate | +Inquiry |
ILF3-5221HCL | Recombinant Human ILF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNJ3 Products
Required fields are marked with *
My Review for All KCNJ3 Products
Required fields are marked with *
0
Inquiry Basket