Recombinant Full Length Rat G Protein-Activated Inward Rectifier Potassium Channel 1(Kcnj3) Protein, His-Tagged
Cat.No. : | RFL30885RF |
Product Overview : | Recombinant Full Length Rat G protein-activated inward rectifier potassium channel 1(Kcnj3) Protein (P63251) (1-501aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-501) |
Form : | Lyophilized powder |
AA Sequence : | MSALRRKFGDDYQVVTTSSSGSGLQPQGPGQGPQQQLVPKKKRQRFVDKNGRCNVQHGNL GSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNY TPCVANVYNFPSAFLFFIETEATIGYGYRYITDKCPEGIILFLFQSILGSIVDAFLIGCM FIKMSQPKKRAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPE GEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILE GIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKE QEEMLLMSSPLIAPAITNSKERHNSVECLDGLDDISTKLPSKLQKITGREDFPKKLLRMS STTSEKAYSLGDLPMKLQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGG PTRMEGNLPAKLRKMNSDRFT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcnj3 |
Synonyms | Kcnj3; Girk1; Kga; G protein-activated inward rectifier potassium channel 1; GIRK-1; Inward rectifier K(+ channel Kir3.1; KGA; KGB1; Potassium channel, inwardly rectifying subfamily J member 3 |
UniProt ID | P63251 |
◆ Recombinant Proteins | ||
PTPN5-1801H | Recombinant Human PTPN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RTN4R-3882H | Recombinant Human RTN4R protein, His-tagged | +Inquiry |
RFL10664MF | Recombinant Full Length Methanocaldococcus Jannaschii Uncharacterized Protein Mj0795.1 (Mj0795.1) Protein, His-Tagged | +Inquiry |
RPL36A-14436M | Recombinant Mouse RPL36A Protein | +Inquiry |
Casc1-1721M | Recombinant Mouse Casc1 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
APOC2-27332TH | Native Human APOC2 | +Inquiry |
TPO-8266H | Native Human Thyroid Peroxidase | +Inquiry |
GPD-189R | Active Native Rabbit Glycerol-3-phosphate dehydrogenase | +Inquiry |
PLC-30 | Active Native Phospholipase C | +Inquiry |
C3b-09R | Native Rat C3b Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2R2-563HCL | Recombinant Human UBE2R2 293 Cell Lysate | +Inquiry |
PTPLB-2687HCL | Recombinant Human PTPLB 293 Cell Lysate | +Inquiry |
MDCK-032WCY | Madin Darby canine kidney MDCK Whole Cell Lysate | +Inquiry |
MSR1-800RCL | Recombinant Rat MSR1 cell lysate | +Inquiry |
LRRC18-4646HCL | Recombinant Human LRRC18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Kcnj3 Products
Required fields are marked with *
My Review for All Kcnj3 Products
Required fields are marked with *
0
Inquiry Basket