Recombinant Full Length Human FUT9 Protein, GST-tagged

• Cat.No.: FUT9-5233HF
• Product Overview: Human FUT9 full-length ORF ( AAH36101.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 359 amino acids
• Description: FUT9 is one of several alpha-3-fucosyltransferases that can catalyze the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides. FUT9 synthesizes the LeX oligosaccharide (CD15), which is expressed in organ buds progressing in mesenchyma during human embryogenesis.[supplied by OMIM
• Molecular Mass: 68.4 kDa
• AA Sequence: MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISACKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FUT9 fucosyltransferase 9 (alpha (1,3) fucosyltransferase) [ Homo sapiens ]
• Official Symbol: FUT9
• Synonyms: fucosyltransferase 9 (alpha (1,3) fucosyltransferase); 4020; Ensembl:ENSG00000172461; alpha-(1,3)-fucosyltransferase;fucT-IX;fucosyltransferase IX;galactoside 3-L-fucosyltransferase; 2.4.1.152; Fuc-TIX
• Gene ID: 10690
• mRNA Refseq: NM_006581
• Protein Refseq: NP_006572
• MIM: 606865
• UniProt ID: Q9Y231