Recombinant Human FUT9 Protein, GST-tagged

Cat.No. : FUT9-4569H
Product Overview : Human FUT9 full-length ORF ( AAH36101.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FUT9 is one of several alpha-3-fucosyltransferases that can catalyze the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides. FUT9 synthesizes the LeX oligosaccharide (CD15), which is expressed in organ buds progressing in mesenchyma during human embryogenesis.[supplied by OMIM
Molecular Mass : 68.4 kDa
AA Sequence : MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISACKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FUT9 fucosyltransferase 9 (alpha (1,3) fucosyltransferase) [ Homo sapiens ]
Official Symbol FUT9
Synonyms fucosyltransferase 9 (alpha (1,3) fucosyltransferase); 4020; Ensembl:ENSG00000172461; alpha-(1,3)-fucosyltransferase;fucT-IX;fucosyltransferase IX;galactoside 3-L-fucosyltransferase; 2.4.1.152; Fuc-TIX
Gene ID 10690
mRNA Refseq NM_006581
Protein Refseq NP_006572
MIM 606865
UniProt ID Q9Y231

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FUT9 Products

Required fields are marked with *

My Review for All FUT9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon