Recombinant Human FUT9, His-tagged
Cat.No. : | FUT9-26H |
Product Overview : | Recombinant Human α-(1,3)-Fucosyltransferase/FUT9 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr33-Asn359) of Human FUT9 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 33-359 a.a. |
Description : | α-(1,3)-Fucosyltransferase (FUT9) is a member of the glycosyltransferase 10 family. FUT9 is a single-pass type II membrane protein that is highly expressed in the forebrain and stomach. FUT9 transfers a fucose to lacto-N-neotetraose but not to either α2,3-sialyl lacto-N-neotetraose or lacto-N-tetraose. FUT9 can catalyze the last step in the biosynthesis of the Lewis-x antigen, which forms part of the Lewis blood group-related antigens. FUT9 can be upregulated by progesterone and ovary hormones. |
AA Sequence : | TNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDR SLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDS DIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVN DKNLIPTISACKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDY NSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWF WNLDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
◆ Recombinant Proteins | ||
FUT9-3395M | Recombinant Mouse FUT9 Protein, His (Fc)-Avi-tagged | +Inquiry |
FUT9-219H | Recombinant Human FUT9 Protein, Thr33-Asn359 | +Inquiry |
FUT9-13048H | Recombinant Human FUT9, GST-tagged | +Inquiry |
RFL11840MF | Recombinant Full Length Mouse Alpha-(1,3)-Fucosyltransferase(Fut9) Protein, His-Tagged | +Inquiry |
FUT9-2416R | Recombinant Rat FUT9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUT9-6111HCL | Recombinant Human FUT9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FUT9 Products
Required fields are marked with *
My Review for All FUT9 Products
Required fields are marked with *
0
Inquiry Basket