Recombinant Human FUT1 Protein, His-tagged

• Cat.No.: FUT1-4558H
• Product Overview: Recombinant human FUT1 Protein (72-365aa) with a 6*His tag was expressed in E.coli.

Specification

• Description: This gene encodes a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the synthesis of soluble A and B antigens. This is one of two genes encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group.
• Source: E.coli
• Species: Human
• Tag: His
• Form: Powder
• AA Sequence: QHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
• Storage: Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
  Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Storage Buffer: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
• Protein length: 72-365 a.a.

Gene Information

• Gene Name: FUT1 fucosyltransferase 1 (H blood group) [ Homo sapiens (human) ]
• Official Symbol: FUT1
• Synonyms: FUT1; fucosyltransferase 1 (H blood group); H; HH; HSC; galactoside 2-alpha-L-fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; H glycosyltransferase; H glycosytransferase; alpha(1,2) fucosyltransferase 1; alpha(1,2)FT 1; blood group H alpha 2-fucosyltransferase; galactoside 2-alpha-L-fucosyltransferase; nonfunctional fucosyltransferase 1; truncated FUT1; truncated alpha(1,2)fucosyltransferase; truncated fucosyltransferase 1; EC 2.4.1.344
• Gene ID: 2523
• mRNA Refseq: NM_000148
• Protein Refseq: NP_000139
• MIM: 211100
• UniProt ID: P19526