Recombinant Full Length Human FOXA3 Protein, GST-tagged

• Cat.No.: FOXA3-5047HF
• Product Overview: Human FOXA3 full-length ORF ( NP_004488.2, 1 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 63.5 kDa
• Protein length: 350 amino acids
• AA Sequence: MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPYPPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLVHGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPPQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXA3 forkhead box A3 [ Homo sapiens ]
• Official Symbol: FOXA3
• Synonyms: FOXA3; forkhead box A3; hepatocyte nuclear factor 3, gamma, HNF3G; hepatocyte nuclear factor 3-gamma; HNF-3G; TCF-3G; HNF-3-gamma; forkhead box protein A3; transcription factor 3G; fork head-related protein FKH H3; hepatocyte nuclear factor 3, gamma; FKHH3; HNF3G; TCF3G; MGC10179
• Gene ID: 3171
• mRNA Refseq: NM_004497
• Protein Refseq: NP_004488
• MIM: 602295
• UniProt ID: P55318