Recombinant Full Length Human FOXA2 Protein, GST-tagged

Cat.No. : FOXA2-5046HF
Product Overview : Human FOXA2 full-length ORF ( NP_068556.1, 1 a.a. - 457 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 457 amino acids
Description : This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Molecular Mass : 74.7 kDa
AA Sequence : MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGAQASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FOXA2 forkhead box A2 [ Homo sapiens ]
Official Symbol FOXA2
Synonyms FOXA2; forkhead box A2; hepatocyte nuclear factor 3, beta, HNF3B; hepatocyte nuclear factor 3-beta; HNF-3B; TCF-3B; HNF-3-beta; forkhead box protein A2; transcription factor 3B; hepatic nuclear factor-3-beta; hepatocyte nuclear factor 3, beta; HNF3B; TCF3B; MGC19807;
Gene ID 3170
mRNA Refseq NM_021784
Protein Refseq NP_068556
MIM 600288
UniProt ID Q9Y261

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FOXA2 Products

Required fields are marked with *

My Review for All FOXA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon