Recombinant Full Length Human FOXA2 Protein, GST-tagged

• Cat.No.: FOXA2-5046HF
• Product Overview: Human FOXA2 full-length ORF ( NP_068556.1, 1 a.a. - 457 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 74.7 kDa
• Protein length: 457 amino acids
• AA Sequence: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGAQASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FOXA2 forkhead box A2 [ Homo sapiens ]
• Official Symbol: FOXA2
• Synonyms: FOXA2; forkhead box A2; hepatocyte nuclear factor 3, beta, HNF3B; hepatocyte nuclear factor 3-beta; HNF-3B; TCF-3B; HNF-3-beta; forkhead box protein A2; transcription factor 3B; hepatic nuclear factor-3-beta; hepatocyte nuclear factor 3, beta; HNF3B; TCF3B; MGC19807
• Gene ID: 3170
• mRNA Refseq: NM_021784
• Protein Refseq: NP_068556
• MIM: 600288
• UniProt ID: Q9Y261