Recombinant Full Length Human FNDC9 Protein, GST-tagged

Cat.No. : FNDC9-3918HF
Product Overview : Human C5orf40 full-length ORF ( NP_001001343.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : FNDC9 (Fibronectin Type III Domain Containing 9) is a Protein Coding gene.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 51.7 kDa
Protein length : 224 amino acids
AA Sequence : MNIEVGNISYTGAIISWSSSEPCLEDYYHIMYRPNWNSIFSGYLRYSFHNEEKVPRTISSVVLEHLAPSTLYFLCISCKKAAFPYRHYCTMFHTLDKSPLAPGSSLVDPQISLWVLMAILLACFTAVLAFICLQFWCVRCHEPRWSYRAGHMEEANGLVRWPEEAPDLGQREEDLQGLPLVEMPRKNSRDGAELDPEANQDAPDAGALQRGGGDPPAILPHCGE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FNDC9 fibronectin type III domain containing 9 [ Homo sapiens (human) ]
Official Symbol FNDC9
Synonyms C5orf40; FNDC9; fibronectin type III domain containing 9; fibronectin type III domain-containing protein 9; fibronectin type-III domain-containing protein C5orf40
Gene ID 408263
mRNA Refseq NM_001001343
Protein Refseq NP_001001343
UniProt ID Q8TBE3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FNDC9 Products

Required fields are marked with *

My Review for All FNDC9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon