Recombinant Human FNDC9 Protein, GST-tagged
Cat.No. : | FNDC9-5259H |
Product Overview : | Human C5orf40 full-length ORF ( NP_001001343.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FNDC9 (Fibronectin Type III Domain Containing 9) is a Protein Coding gene. |
Molecular Mass : | 51.7 kDa |
AA Sequence : | MNIEVGNISYTGAIISWSSSEPCLEDYYHIMYRPNWNSIFSGYLRYSFHNEEKVPRTISSVVLEHLAPSTLYFLCISCKKAAFPYRHYCTMFHTLDKSPLAPGSSLVDPQISLWVLMAILLACFTAVLAFICLQFWCVRCHEPRWSYRAGHMEEANGLVRWPEEAPDLGQREEDLQGLPLVEMPRKNSRDGAELDPEANQDAPDAGALQRGGGDPPAILPHCGE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FNDC9 fibronectin type III domain containing 9 [ Homo sapiens (human) ] |
Official Symbol | FNDC9 |
Synonyms | C5orf40; FNDC9; fibronectin type III domain containing 9; fibronectin type III domain-containing protein 9; fibronectin type-III domain-containing protein C5orf40 |
Gene ID | 408263 |
mRNA Refseq | NM_001001343 |
Protein Refseq | NP_001001343 |
UniProt ID | Q8TBE3 |
◆ Cell & Tissue Lysates | ||
FNDC9-1093HCL | Recombinant Human FNDC9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FNDC9 Products
Required fields are marked with *
My Review for All FNDC9 Products
Required fields are marked with *
0
Inquiry Basket