Recombinant Full Length Human FMNL2 Protein, GST-tagged

• Cat.No.: FMNL2-4984HF
• Product Overview: Human FMNL2 full-length ORF ( AAH36492, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a formin-related protein. Formin-related proteins have been implicated in morphogenesis, cytokinesis, and cell polarity. Alternatively spliced transcript variants encoding different isoforms have been described but their full-length nature has yet to be determined. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 45.32 kDa
• Protein length: 178 amino acids
• AA Sequence: MDLTKREYTMHDHNTLLKEFILNNEGKLKKLQDDAKIAQDAFDDVVKYFGENPKTTPPSVFFPVFVRFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQQELIAELRRRQVKDNRHVYEGKDGAIEDIITALKKNNITKFPNVHSRVRISSSTPVVEDTQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FMNL2 formin-like 2 [ Homo sapiens ]
• Official Symbol: FMNL2
• Synonyms: FMNL2; formin-like 2; FHOD2, formin homology 2 domain containing 2; formin-like protein 2; KIAA1902; formin homology 2 domain containing 2; formin homology 2 domain-containing protein 2; FHOD2; FLJ37546
• Gene ID: 114793
• mRNA Refseq: NM_052905
• Protein Refseq: NP_443137
• MIM: 616285
• UniProt ID: Q96PY5