Recombinant Human FKBP5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FKBP5-741H
• Product Overview: FKBP5 MS Standard C13 and N15-labeled recombinant protein (NP_004108) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 51 kDa
• AA Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDLKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FKBP5 FK506 binding protein 5 [ Homo sapiens (human) ]
• Official Symbol: FKBP5
• Synonyms: FKBP5; FK506 binding protein 5; peptidyl-prolyl cis-trans isomerase FKBP5; FKBP51; FKBP54; P54; PPIase; Ptg 10; FKBP-5; FKBP-51; rotamase; 51 kDa FKBP; FF1 antigen; PPIase FKBP5; HSP90-binding immunophilin; T-cell FK506-binding protein; androgen-regulated protein 6; 51 kDa FK506-binding protein 5; peptidylprolyl cis-trans isomerase; 54 kDa progesterone receptor-associated immunophilin; AIG6; Ptg-10; MGC111006
• Gene ID: 2289
• mRNA Refseq: NM_004117
• Protein Refseq: NP_004108
• MIM: 602623
• UniProt ID: Q13451