Recombinant Full Length Human FKBP3 Protein, GST-tagged

• Cat.No.: FKBP3-4804HF
• Product Overview: Human FKBP3 full-length ORF ( AAH16288, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 50.38 kDa
• Protein length: 224 amino acids
• AA Sequence: MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKEKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FKBP3 FK506 binding protein 3, 25kDa [ Homo sapiens ]
• Official Symbol: FKBP3
• Synonyms: FKBP3; FK506 binding protein 3, 25kDa; FK506 binding protein 3 (25kD); peptidyl-prolyl cis-trans isomerase FKBP3; FKBP 25; PPIase; rotamase; 25 kDa FKBP; PPIase FKBP3; immunophilin FKBP25; rapamycin binding protein; 25 kDa FK506-binding protein; FK506-binding protein 3 (25kD); FK506-binding protein 25, T-cell; rapamycin-selective 25 kDa immunophilin; FKBP-3; FKBP25; FKBP-25
• Gene ID: 2287
• mRNA Refseq: NM_002013
• Protein Refseq: NP_002004
• MIM: 186947
• UniProt ID: Q00688