Recombinant Full Length Human FGFBP3 Protein, GST-tagged

• Cat.No.: FGFBP3-4843HF
• Product Overview: Human FGFBP3 full-length ORF (BAC11602.1, 1 a.a. - 258 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: FGFBP3 (Fibroblast Growth Factor Binding Protein 3) is a Protein Coding gene. Among its related pathways are Signaling by FGFR2 and Signaling by GPCR. GO annotations related to this gene include heparin binding and fibroblast growth factor binding.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 54 kDa
• Protein length: 258 amino acids
• AA Sequence: MTPPKLRASLSPSLLLLLSGCLLAAARREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEAAAGSELALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKGHGAELRLVPRASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNVGKRKAALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FGFBP3 fibroblast growth factor binding protein 3 [ Homo sapiens (human) ]
• Official Symbol: FGFBP3
• Synonyms: FGFBP3; fibroblast growth factor binding protein 3; FGF-BP3; C10orf13; fibroblast growth factor-binding protein 3; FGF-binding protein 3; FGFBP-3
• Gene ID: 143282
• mRNA Refseq: NM_152429
• Protein Refseq: NP_689642
• UniProt ID: Q8TAT2