Recombinant Full Length Human FAU Protein, GST-tagged

Cat.No. : FAU-4875HF
Product Overview : Human FAU full-length ORF ( AAH33877, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome and displays antimicrobial activity. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. [provided by RefSeq, Nov 2014]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 40.37 kDa
Protein length : 133 amino acids
AA Sequence : MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTQEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAU Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed [ Homo sapiens ]
Official Symbol FAU
Synonyms FAU; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed; Finkel Biskis Reilly murine sarcoma virus (FBR MuSV) ubiquitously expressed (fox derived); ubiquitin-like protein fubi and ribosomal protein S30; asr1; FLJ22986; Fub1; Fubi; MNSFbeta; Monoclonal nonspecific suppressor factor beta; ribosomal protein S30; RPS30; S30; 40S ribosomal protein S30; ubiquitin-like-S30 fusion protein; FAU-encoded ubiquitin-like protein; FBR-MuSV-associated ubiquitously expressed; monoclonal nonspecific suppressor factor beta; Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived); FAU1;
Gene ID 2197
mRNA Refseq NM_001997
Protein Refseq NP_001988
MIM 134690
UniProt ID P35544

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAU Products

Required fields are marked with *

My Review for All FAU Products

Required fields are marked with *

0

Inquiry Basket

cartIcon