Recombinant Full Length Human Fatty Acid Desaturase 2-Like Protein Protein, His-Tagged
Cat.No. : | RFL32870HF |
Product Overview : | Recombinant Full Length Human Fatty acid desaturase 2-like protein Protein (A8MWK0) (1-482aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-482) |
Form : | Lyophilized powder |
AA Sequence : | MKFEEKCGDNGSIVGRNQSYPGEKHQPKGKPIANGEAEVYAKQEANGKCSTPRKSLSMYT WLEIQRHNHEADQLVINCKVYNVSSWADRHPGGHQVLNHCAGEDAMDVFRAMHPELDIVQ LYLKPLLIGELAPGEPSQERHKNSQLVKDFQELWSIAEAMNMFHANLGFFFLHFVQILIL EVLAWLIVYHFGSGWPVTMFISFLLTISQASSSFLQHDAGHLSIFRKSKWNHVVHKFVMC HLKGLSADRWNYWHFEQHVKPNIYPKDPDIDTDPLFLLGDSQPVKYGKKKIKYINYEEQH LYFYKVWLPLFMPVYLKLPSMQAMYLQRYWVCFSLQDITWVSSFYIYFITFGLYYGIFGT MLLIYLVKFLESPWIVYVTQMSHITMRMSTEENRDWLTTQVLATCNTESFFNDFTGHLNF QIEHHLFPTMPRHNYHKVAPLVRSLCAKHGLHYVNKPMLRAFGDIVRALKKSAALWADAY YE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FADS2P1 |
Synonyms | FADS2B; FADS2P1; Putative fatty acid desaturase 2-like protein FADS2B; Fatty acid desaturase 2 pseudogene 1; Fatty acid desaturase 2B, pseudogene |
UniProt ID | A8MWK0 |
◆ Recombinant Proteins | ||
CK137956-2171M | Recombinant Mouse CK137956 Protein, Myc/DDK-tagged | +Inquiry |
IL2RGB-6626Z | Recombinant Zebrafish IL2RGB | +Inquiry |
RFL30964DF | Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 98B(Gr98B) Protein, His-Tagged | +Inquiry |
CDC42SE1-1282R | Recombinant Rat CDC42SE1 Protein | +Inquiry |
CFHR2-320H | Recombinant Human CFHR2, His-tagged | +Inquiry |
◆ Native Proteins | ||
C.Pneumoniae-32 | Native Chlamydia pneumoniae Antigen | +Inquiry |
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
sPLA2-60B | Native Bee Venom sPLA2 Protein | +Inquiry |
ORM1-35H | Native Human Alpha 1 Acid Glycoprotein | +Inquiry |
COL2A1-14B | Native Bovine COL2A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SkeletalMuscles-470C | Cat Skeletal Muscles Lysate, Total Protein | +Inquiry |
PTPN18-1437HCL | Recombinant Human PTPN18 cell lysate | +Inquiry |
PFN2-3268HCL | Recombinant Human PFN2 293 Cell Lysate | +Inquiry |
STAT3-1417HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
Cerebral Cortex-74H | Human Cerebral Cortex Membrane Lysate | +Inquiry |
|
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FADS2P1 Products
Required fields are marked with *
My Review for All FADS2P1 Products
Required fields are marked with *
0
Inquiry Basket