Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 98B(Gr98B) Protein, His-Tagged
Cat.No. : | RFL30964DF |
Product Overview : | Recombinant Full Length Drosophila melanogaster Putative gustatory receptor 98b(Gr98b) Protein (Q9VB26) (1-403aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Drosophila melanogaster (Fruit fly) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-403) |
Form : | Lyophilized powder |
AA Sequence : | MVAQKSRLLARAFPYLDIFSVFALTPPPQSFGHTPHRRLRWYLMTGYVFYATAILATVFI VSYFNIIAIDEEVLEYNVSDFTRVMGNIQKSLYSIMAIANHLNMLINYRRLGGIYKDIAD LEMDMDEASQCFGGQRQRFSFRFRMALCVGVWMILMVGSMPRLTMTAMGPFVSTLLKILT EFVMIMQQLKSLEYCVFVLIIYELVLRLRRTLSQLQEEFQDCEQQDMLQALCVALKRNQL LLGRIWRLEGDVGSYFTPTMLLLFLYNGLTILHMVNWAYINKFLYDSCCQYERFLVCSTL LVNLLLPCLLSQRCINAYNCFPRILHKIRCTSADPNFAMLTRGLREYSLQMEHLKLRFTC GGLFDINLKYFGGLLVTIFGYIIILIQFKVQAIAANRYKKVVN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gr98b |
Synonyms | Gr98b; GR98B.2; CG31059; Putative gustatory receptor 98b |
UniProt ID | Q9VB26 |
◆ Recombinant Proteins | ||
EPCAM-1307R | Recombinant Rhesus Macaque EPCAM Protein, His (Fc)-Avi-tagged | +Inquiry |
WT1-10211M | Recombinant Mouse WT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRRC1-3067C | Recombinant Chicken PRRC1 | +Inquiry |
Il3ra-918MAF647 | Recombinant Mouse Il3ra Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
KRT39-2978R | Recombinant Rat KRT39 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
VTN-5410H | Native Human Vitronectin | +Inquiry |
CP-8074M | Native Mouse Serum Ceruloplasmin | +Inquiry |
GSN-876P | Active Native Porcine GSN Protein | +Inquiry |
SNCA-27345TH | Native Human SNCA | +Inquiry |
FSME-08 | Native FSME (TBE) Virus Antigen (Premium) | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF10-2311HCL | Recombinant Human RNF10 293 Cell Lysate | +Inquiry |
GPX4-308HCL | Recombinant Human GPX4 lysate | +Inquiry |
LSAMP-1755HCL | Recombinant Human LSAMP cell lysate | +Inquiry |
AHNAK-8963HCL | Recombinant Human AHNAK 293 Cell Lysate | +Inquiry |
POC5-3061HCL | Recombinant Human POC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gr98b Products
Required fields are marked with *
My Review for All Gr98b Products
Required fields are marked with *
0
Inquiry Basket