Recombinant Full Length Human FAM136A Protein, GST-tagged

• Cat.No.: FAM136A-4513HF
• Product Overview: Human FAM136A full-length ORF (BAB55208.1, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a mitochondrially localized protein that is highly conserved across species. The gene is expressed in a variety of tissues including human lymphoblast cells and rat neurosensorial epithelium of the cristaampullaris. A mutation in this gene has been associated with familial Meniere's disease, a chronic disorder of the inner ear. Several pseudogenes of this gene are found on other chromosomes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 42.1 kDa
• Protein length: 138 amino acids
• AA Sequence: MAELQQLRVQEAMESMVKSLERENIRKMQGLMFRCSASCCEDSQAFMKQVHQCIERCHVPLAQAQALVTSELEKFQDRLARCTMHCNDKAKDSIDAGSKELQVKQQLDSCVTKCVDDHMHLIPTMTKKMKEALLSIGK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM136A family with sequence similarity 136, member A [ Homo sapiens ]
• Official Symbol: FAM136A
• Synonyms: FAM136A; family with sequence similarity 136, member A; protein FAM136A; FLJ14668; hypothetical protein FLJ14668
• Gene ID: 84908
• mRNA Refseq: NM_032822
• Protein Refseq: NP_116211
• MIM: 616275
• UniProt ID: Q96C01