Recombinant Full Length Human FAM120AOS Protein, GST-tagged

• Cat.No.: FAM120AOS-4493HF
• Product Overview: Human FAM120AOS full-length ORF ( AAI60143.1, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Differences in the expression level of this gene are associated with the survival rate of those with glioma. [provided by RefSeq, May 2017]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 28.2 kDa
• Protein length: 256 amino acids
• AA Sequence: MGKTKDIGDDDTVASEFWSGALSQPSSVPTRPRTPNRDSWRRAWAARGLHPRPSILQPGPARLSRARAGGTRCPQRRHGRATFCALGRGIGVRRGPGPRPARIPGLTLTWKRMSARRMQWAMQTGGRNQTFGGGVPLFWTWLTICCAVWRSLPCRLTHSCSRAFSSAPLKKTKSSMLPPKQALASAARNLCRGAGCNRQAVAGQLLPSTWSLHAHGLAKEAPILPVKKISRSCSVNNKVSKKTTKPPTLRSFLSPI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FAM120AOS family with sequence similarity 120A opposite strand [ Homo sapiens (human) ]
• Official Symbol: FAM120AOS
• Synonyms: FAM120AOS; family with sequence similarity 120A opposite strand; Family With Sequence Similarity 120A Opposite Strand; FAM120A Opposite Strand Protein; C9orf10OS; Chromosome 9 Open Reading Frame 10 Opposite Strand; Uncharacterized Protein FAM120AOS; uncharacterized protein FAM120AOS; FAM120A opposite strand protein
• Gene ID: 158293
• mRNA Refseq: NM_001322224
• Protein Refseq: NP_001309153
• UniProt ID: Q5T036