Recombinant Full Length Human FAM120AOS Protein, GST-tagged

Cat.No. : FAM120AOS-4493HF
Product Overview : Human FAM120AOS full-length ORF ( AAI60143.1, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Differences in the expression level of this gene are associated with the survival rate of those with glioma. [provided by RefSeq, May 2017]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 28.2 kDa
Protein length : 256 amino acids
AA Sequence : MGKTKDIGDDDTVASEFWSGALSQPSSVPTRPRTPNRDSWRRAWAARGLHPRPSILQPGPARLSRARAGGTRCPQRRHGRATFCALGRGIGVRRGPGPRPARIPGLTLTWKRMSARRMQWAMQTGGRNQTFGGGVPLFWTWLTICCAVWRSLPCRLTHSCSRAFSSAPLKKTKSSMLPPKQALASAARNLCRGAGCNRQAVAGQLLPSTWSLHAHGLAKEAPILPVKKISRSCSVNNKVSKKTTKPPTLRSFLSPI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM120AOS family with sequence similarity 120A opposite strand [ Homo sapiens (human) ]
Official Symbol FAM120AOS
Synonyms FAM120AOS; family with sequence similarity 120A opposite strand; Family With Sequence Similarity 120A Opposite Strand; FAM120A Opposite Strand Protein; C9orf10OS; Chromosome 9 Open Reading Frame 10 Opposite Strand; Uncharacterized Protein FAM120AOS; uncharacterized protein FAM120AOS; FAM120A opposite strand protein
Gene ID 158293
mRNA Refseq NM_001322224
Protein Refseq NP_001309153
UniProt ID Q5T036

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All FAM120AOS Products

Required fields are marked with *

My Review for All FAM120AOS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon