Recombinant Full Length Human ENTPD3 Protein, GST-tagged

• Cat.No.: ENTPD3-4332HF
• Product Overview: Human ENTPD3 full-length ORF ( AAH29869.1, 1 a.a. - 452 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a plasma membrane-bound divalent cation-dependent E-type nucleotidase. The encoded protein is involved in the regulation of extracellular levels of ATP by hydrolysis of it and other nucleotides. Multiple transcript variants have been described. [provided by RefSeq, May 2014]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 77.1 kDa
• Protein length: 452 amino acids
• AA Sequence: MFTVLTRQPCEQAGLKALYRTPTVIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ENTPD3 ectonucleoside triphosphate diphosphohydrolase 3 [ Homo sapiens ]
• Official Symbol: ENTPD3
• Synonyms: ENTPD3; ectonucleoside triphosphate diphosphohydrolase 3; CD39L3; HB6; NTPDase 3; CD39-like 3; ecto-ATPase 3; ecto-ATPDase 3; ecto-apyrase 3; CD39 antigen-like 3; ecto-ATP diphosphohydrolase 3; NTPDase-3; FLJ93839
• Gene ID: 956
• mRNA Refseq: NM_001248
• Protein Refseq: NP_001239
• MIM: 603161
• UniProt ID: O75355