Recombinant Human ENTPD3 Protein, GST-tagged
Cat.No. : | ENTPD3-3333H |
Product Overview : | Human ENTPD3 full-length ORF ( AAH29869.1, 1 a.a. - 452 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a plasma membrane-bound divalent cation-dependent E-type nucleotidase. The encoded protein is involved in the regulation of extracellular levels of ATP by hydrolysis of it and other nucleotides. Multiple transcript variants have been described. [provided by RefSeq, May 2014] |
Molecular Mass : | 77.1 kDa |
AA Sequence : | MFTVLTRQPCEQAGLKALYRTPTVIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEKEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ENTPD3 ectonucleoside triphosphate diphosphohydrolase 3 [ Homo sapiens ] |
Official Symbol | ENTPD3 |
Synonyms | ENTPD3; ectonucleoside triphosphate diphosphohydrolase 3; CD39L3; HB6; NTPDase 3; CD39-like 3; ecto-ATPase 3; ecto-ATPDase 3; ecto-apyrase 3; CD39 antigen-like 3; ecto-ATP diphosphohydrolase 3; NTPDase-3; FLJ93839; |
Gene ID | 956 |
mRNA Refseq | NM_001248 |
Protein Refseq | NP_001239 |
MIM | 603161 |
UniProt ID | O75355 |
◆ Recombinant Proteins | ||
ENTPD3-847H | Recombinant Human ENTPD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENTPD3-5433Z | Recombinant Zebrafish ENTPD3 | +Inquiry |
ENTPD3-210H | Active Recombinant Human ENTPD3, His-tagged | +Inquiry |
ENTPD3-1361H | Recombinant Human ENTPD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ENTPD3-3370M | Recombinant Mouse ENTPD3 protein(Gln44-Pro485), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENTPD3-475HCL | Recombinant Human ENTPD3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENTPD3 Products
Required fields are marked with *
My Review for All ENTPD3 Products
Required fields are marked with *
0
Inquiry Basket