Recombinant Full Length Human ENO2 Protein, C-Flag-tagged

• Cat.No.: ENO2-171HFL
• Product Overview: Recombinant Full Length Human ENO2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme, a homodimer, is found in mature neurons and cells of neuronal origin. A switch from alpha enolase to gamma enolase occurs in neural tissue during development in rats and primates.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 47.1 kDa
• AA Sequence: MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHIN STIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGN SDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDE GGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALY QDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSV TEAIQACKLAQENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
  ARFAGHNFRNPSVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Glycolysis / Gluconeogenesis, Metabolic pathways, RNA degradation
• Full Length: Full L.

Gene Information

• Gene Name: ENO2 enolase 2 [ Homo sapiens (human) ]
• Official Symbol: ENO2
• Synonyms: NSE; HEL-S-279
• Gene ID: 2026
• mRNA Refseq: NM_001975.3
• Protein Refseq: NP_001966.1
• MIM: 131360
• UniProt ID: P09104