Recombinant Full Length Human ELF3 Protein, GST-tagged

Cat.No. : ELF3-4348HF
Product Overview : Human ELF3 full-length ORF ( AAH03569.1, 1 a.a. - 371 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 371 amino acids
Description : ELF3 (E74 Like ETS Transcription Factor 3) is a Protein Coding gene. Diseases associated with ELF3 include Sarcoma, Synovial and Growth Hormone Deficiency, Isolated, Type Ii. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and transcription coactivator activity. An important paralog of this gene is EHF.
Molecular Mass : 67.9 kDa
AA Sequence : MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ELF3 E74-like factor 3 (ets domain transcription factor, epithelial-specific ) [ Homo sapiens ]
Official Symbol ELF3
Synonyms ELF3; E74-like factor 3 (ets domain transcription factor, epithelial-specific ); ESX; ETS-related transcription factor Elf-3; EPR 1; ERT; ESE 1; epithelial-restricted with serine box; epithelium-restricted Ets protein ESX; epithelium-specific Ets transcription factor 1; E74-like factor 3 (ets domain transcription factor); ets domain transcription factor, serine box (epithelial-specific); E74-like factor 3 (ETS domain transcription factor, serine box, epithelial-specific); EPR-1; ESE-1;
Gene ID 1999
mRNA Refseq NM_001114309
Protein Refseq NP_001107781
MIM 602191
UniProt ID P78545

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ELF3 Products

Required fields are marked with *

My Review for All ELF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon