Recombinant Human ELF3 Protein, GST-tagged

• Cat.No.: ELF3-3240H
• Product Overview: Human ELF3 full-length ORF ( AAH03569.1, 1 a.a. - 371 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ELF3 (E74 Like ETS Transcription Factor 3) is a Protein Coding gene. Diseases associated with ELF3 include Sarcoma, Synovial and Growth Hormone Deficiency, Isolated, Type Ii. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and transcription coactivator activity. An important paralog of this gene is EHF.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 67.9 kDa
• AA Sequence: MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ELF3 E74-like factor 3 (ets domain transcription factor, epithelial-specific ) [ Homo sapiens ]
• Official Symbol: ELF3
• Synonyms: ELF3; E74-like factor 3 (ets domain transcription factor, epithelial-specific ); ESX; ETS-related transcription factor Elf-3; EPR 1; ERT; ESE 1; epithelial-restricted with serine box; epithelium-restricted Ets protein ESX; epithelium-specific Ets transcription factor 1; E74-like factor 3 (ets domain transcription factor); ets domain transcription factor, serine box (epithelial-specific); E74-like factor 3 (ETS domain transcription factor, serine box, epithelial-specific); EPR-1; ESE-1
• Gene ID: 1999
• mRNA Refseq: NM_001114309
• Protein Refseq: NP_001107781
• MIM: 602191
• UniProt ID: P78545