Recombinant Human EIF3E protein, His-tagged

Cat.No. : EIF3E-3596H
Product Overview : Recombinant Human EIF3E protein(146-445 aa), fused to His tag, was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 146-445 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : GAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name EIF3E eukaryotic translation initiation factor 3, subunit E [ Homo sapiens ]
Official Symbol EIF3E
Synonyms EIF3E; eukaryotic translation initiation factor 3, subunit E; EIF3S6, eukaryotic translation initiation factor 3, subunit 6 48kDa , INT6; eukaryotic translation initiation factor 3 subunit E; eIF3 p48; eIF3e; eIF-3 p48; mammary tumor-associated protein INT6; viral integration site protein INT-6 homolog; eukaryotic translation initiation factor 3 subunit 6; murine mammary tumor integration site 6 (oncogene homolog); eukaryotic translation initiation factor 3, subunit 6 48kDa; eukaryotic translation initiation factor 3, subunit 6 (48kD); INT6; EIF3S6; EIF3-P48; eIF3-p46;
Gene ID 3646
mRNA Refseq NM_001568
Protein Refseq NP_001559
MIM 602210
UniProt ID P60228

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EIF3E Products

Required fields are marked with *

My Review for All EIF3E Products

Required fields are marked with *

0

Inquiry Basket

cartIcon