Recombinant Full Length Human EIF2B1 Protein, GST-tagged

• Cat.No.: EIF2B1-4489HF
• Product Overview: Human EIF2B1 full-length ORF ( NP_001405.1, 1 a.a. - 305 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 305 amino acids
• Description: This gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factor for eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and the genes encoding other EIF2B subunits have been associated with leukoencephalopathy with vanishing white matter. [provided by RefSeq, Oct 2009]
• Molecular Mass: 60.1 kDa
• AA Sequence: MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF2B1 eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa [ Homo sapiens ]
• Official Symbol: EIF2B1
• Synonyms: EIF2B1; eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa; EIF2B, eukaryotic translation initiation factor 2B, subunit 1 (alpha, 26kD); translation initiation factor eIF-2B subunit alpha; EIF 2B; EIF 2Balpha; EIF2BA; eIF-2B GDP-GTP exchange factor subunit alpha; EIF2B; MGC117409; MGC125868; MGC125869
• Gene ID: 1967
• mRNA Refseq: NM_001414
• Protein Refseq: NP_001405
• MIM: 606686
• UniProt ID: Q14232