Recombinant Full Length Human EDNRA Protein

• Cat.No.: EDNRA-6775HF
• Product Overview: Human EDNRA full-length ORF (ENSP00000315011) recombinant protein without tag was expressed in wheat germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: was amino acids
• Description: This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
• Form: Liquid
• Molecular Mass: 48.7 kDa
• AA Sequence: METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: EDNRA endothelin receptor type A [ Homo sapiens (human) ]
• Official Symbol: EDNRA
• Synonyms: EDNRA; endothelin receptor type A; ETA; ET-A; ETAR; ETRA; MFDA; ETA-R; hET-AR endothelin-1 receptor; G protein-coupled receptor; endothelin receptor subtype A; endothelin-1-specific receptor
• Gene ID: 1909
• mRNA Refseq: NM_001957
• Protein Refseq: NP_001948
• MIM: 131243
• UniProt ID: P25101