Recombinant Full Length Human EDF1 Protein, GST-tagged
Cat.No. : | EDF1-4188HF |
Product Overview : | Human EDF1 full-length ORF ( AAH15500.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 148 amino acids |
Description : | This gene encodes a protein that may regulate endothelial cell differentiation, lipid metabolism, and hormone-induced cardiomyocyte hypertrophy. The encoded protein has also been found to act as a transcriptional coactivator by interconnecting the general transcription factor TATA element-binding protein (TBP) and gene-specific activators. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Molecular Mass : | 42.02 kDa |
AA Sequence : | MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQSRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EDF1 endothelial differentiation-related factor 1 [ Homo sapiens ] |
Official Symbol | EDF1 |
Synonyms | EDF1; endothelial differentiation-related factor 1; EDF 1; multiprotein bridging factor 1; MBF1; EDF-1; MGC9058; |
Gene ID | 8721 |
mRNA Refseq | NM_003792 |
Protein Refseq | NP_003783 |
MIM | 605107 |
UniProt ID | O60869 |
◆ Recombinant Proteins | ||
EDF1-12280H | Recombinant Human EDF1 protein, GST-tagged | +Inquiry |
EDF1-2258H | Recombinant Human EDF1 Protein (Ala2-Lys148), C-His tagged | +Inquiry |
EDF1-1204R | Recombinant Rhesus Macaque EDF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EDF1-2774H | Recombinant Human EDF1, His-tagged | +Inquiry |
EDF1-11008Z | Recombinant Zebrafish EDF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDF1-6723HCL | Recombinant Human EDF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDF1 Products
Required fields are marked with *
My Review for All EDF1 Products
Required fields are marked with *
0
Inquiry Basket