Recombinant Full Length Human DYNLRB1 Protein, GST-tagged

Cat.No. : DYNLRB1-4159HF
Product Overview : Human DNCL2A full-length ORF ( AAH02481, 22 a.a. - 96 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene is a member of the roadblock dynein light chain family. The encoded cytoplasmic protein is capable of binding intermediate chain proteins, interacts with transforming growth factor-beta, and has been implicated in the regulation of actin modulating proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 12 and 18. [provided by RefSeq, Aug 2013]
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 33.99 kDa
Protein length : 22-96 amino acids
AA Sequence : VVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DYNLRB1 dynein, light chain, roadblock-type 1 [ Homo sapiens ]
Official Symbol DYNLRB1
Synonyms DYNLRB1; dynein, light chain, roadblock-type 1; DNCL2A, dynein, cytoplasmic, light polypeptide 2A; dynein light chain roadblock-type 1; DNLC2A; roadblock domain containing 1; ROBLD1; Roadblock-1; ROBL/LC7-like 1; bithoraxoid-like protein; dynein-associated protein Km23; dynein-associated protein HKM23; cytoplasmic dynein light chain 2A; dynein light chain 2A, cytoplasmic; roadblock domain-containing protein 1; dynein, cytoplasmic, light polypeptide 2A; BLP; BITH; DNCL2A;
Gene ID 83658
mRNA Refseq NM_014183
Protein Refseq NP_054902
MIM 607167
UniProt ID Q9NP97

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DYNLRB1 Products

Required fields are marked with *

My Review for All DYNLRB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon