Recombinant Full Length Human DUSP14 Protein, GST-tagged

• Cat.No.: DUSP14-4097HF
• Product Overview: Human DUSP14 full-length ORF ( AAH00370, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP14 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 47.52 kDa
• Protein length: 198 amino acids
• AA Sequence: MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
• Applications: Phosphatase Assay (Cdc25)
  Phosphatase Assay (PTP)
  Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DUSP14 dual specificity phosphatase 14 [ Homo sapiens ]
• Official Symbol: DUSP14
• Synonyms: DUSP14; dual specificity phosphatase 14; dual specificity protein phosphatase 14; MKP 1 like protein tyrosine phosphatase; MKP L; MKP6; MKP-6; MAP kinase phosphatase 6; MKP-1 like protein tyrosine phosphatase; MKP-1-like protein tyrosine phosphatase; mitogen-activated protein kinase phosphatase 6; MKP-L
• Gene ID: 11072
• mRNA Refseq: NM_007026
• Protein Refseq: NP_008957
• MIM: 606618
• UniProt ID: O95147