Recombinant Human DUSP14 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DUSP14-4928H
• Product Overview: DUSP14 MS Standard C13 and N15-labeled recombinant protein (NP_008957) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP14 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22.3 kDa
• AA Sequence: MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGITRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DUSP14 dual specificity phosphatase 14 [ Homo sapiens (human) ]
• Official Symbol: DUSP14
• Synonyms: DUSP14; dual specificity phosphatase 14; dual specificity protein phosphatase 14; MKP 1 like protein tyrosine phosphatase; MKP L; MKP6; MKP-6; MAP kinase phosphatase 6; MKP-1 like protein tyrosine phosphatase; MKP-1-like protein tyrosine phosphatase; mitogen-activated protein kinase phosphatase 6; MKP-L
• Gene ID: 11072
• mRNA Refseq: NM_007026
• Protein Refseq: NP_008957
• MIM: 606618
• UniProt ID: O95147