Recombinant Full Length Human DPCR1 Protein, GST-tagged

• Cat.No.: DPCR1-4008HF
• Product Overview: Human DPCR1 full-length ORF ( NP_543146.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 235 amino acids
• Description: DPCR1 (Diffuse Panbronchiolitis Critical Region 1) is a Protein Coding gene. Diseases associated with DPCR1 include Panbronchiolitis, Diffuse.
• Molecular Mass: 52.1 kDa
• AA Sequence: MTQVTEKSTEHPEKTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKGIHAGQMGENDSFPAWAIVIVVLVAVILLLVFLGLIFLVSYMMRTRRTLTQNTQYNDAEDEGGPNSYPVYLMEQQNLGMGQIPSPR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DPCR1 diffuse panbronchiolitis critical region 1 [ Homo sapiens ]
• Official Symbol: DPCR1
• Synonyms: DPCR1; diffuse panbronchiolitis critical region 1; diffuse panbronchiolitis critical region protein 1; bCX105N19.6; PBLT; MGC126710; MGC126712
• Gene ID: 135656
• mRNA Refseq: NM_080870
• Protein Refseq: NP_543146
• MIM: 613928
• UniProt ID: Q3MIW9