Recombinant Human DPCR1 Protein, GST-tagged

Cat.No. : DPCR1-2823H
Product Overview : Human DPCR1 full-length ORF ( NP_543146.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DPCR1 (Diffuse Panbronchiolitis Critical Region 1) is a Protein Coding gene. Diseases associated with DPCR1 include Panbronchiolitis, Diffuse.
Molecular Mass : 52.1 kDa
AA Sequence : MTQVTEKSTEHPEKTTSTTEKTTRTPEKPTLYSEKTICTKGKNTPVPEKPTENLGNTTLTTETIKAPVKSTENPEKTAAVTKTIKPSVKVTGDKSLTTTSSHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKGIHAGQMGENDSFPAWAIVIVVLVAVILLLVFLGLIFLVSYMMRTRRTLTQNTQYNDAEDEGGPNSYPVYLMEQQNLGMGQIPSPR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DPCR1 diffuse panbronchiolitis critical region 1 [ Homo sapiens ]
Official Symbol DPCR1
Synonyms DPCR1; diffuse panbronchiolitis critical region 1; diffuse panbronchiolitis critical region protein 1; bCX105N19.6; PBLT; MGC126710; MGC126712;
Gene ID 135656
mRNA Refseq NM_080870
Protein Refseq NP_543146
MIM 613928
UniProt ID Q3MIW9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DPCR1 Products

Required fields are marked with *

My Review for All DPCR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon