Recombinant Full Length Human DNAJC9 Protein, GST-tagged

Cat.No. : DNAJC9-4026HF
Product Overview : Human DNAJC9 full-length ORF (BAG52832.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 260 amino acids
Description : DNAJC9 (DnaJ Heat Shock Protein Family (Hsp40) Member C9) is a Protein Coding gene. Diseases associated with DNAJC9 include Corneal Degeneration and Recurrent Corneal Erosion.
Molecular Mass : 56.3 kDa
AA Sequence : MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIGAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNAJC9 DnaJ (Hsp40) homolog, subfamily C, member 9 [ Homo sapiens ]
Official Symbol DNAJC9
Synonyms DNAJC9; DnaJ (Hsp40) homolog, subfamily C, member 9; dnaJ homolog subfamily C member 9; JDD1; SB73; DnaJ protein SB73; HDJC9; KIAA0974;
Gene ID 23234
mRNA Refseq NM_015190
Protein Refseq NP_056005
MIM 611206
UniProt ID Q8WXX5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DNAJC9 Products

Required fields are marked with *

My Review for All DNAJC9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon