Recombinant Full Length Human DLX6 Protein, GST-tagged

• Cat.No.: DLX6-4007HF
• Product Overview: Human DLX6 full-length ORF ( AAH69363.1, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 175 amino acids
• Description: This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. This family is comprised of at least 6 different members that encode proteins with roles in forebrain and craniofacial development. This gene is in a tail-to-tail configuration with another member of the family on the long arm of chromosome 7. [provided by RefSeq, Jul 2008]
• Molecular Mass: 46.1 kDa
• AA Sequence: MSHSQHSPYLQSYHNSSAAAQTRGDDTDQQKTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLLKQGSNPHESDPLQGSAALSPRSPALPPVWDVSASAKGVSMPPNSYMPGYSHWYSSPHQDTMQRPQMM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DLX6 distal-less homeobox 6 [ Homo sapiens ]
• Official Symbol: DLX6
• Synonyms: DLX6; distal-less homeobox 6; distal less homeo box 6; homeobox protein DLX-6; distal-less homeo box 6; MGC125282; MGC125283; MGC125284; MGC125285
• Gene ID: 1750
• mRNA Refseq: NM_005222
• Protein Refseq: NP_005213
• MIM: 600030
• UniProt ID: P56179