Recombinant Full Length Human DHRSX Protein, C-Flag-tagged
Cat.No. : | DHRSX-1749HFL |
Product Overview : | Recombinant Full Length Human DHRSX Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable oxidoreductase activity. Involved in positive regulation of autophagy. Located in extracellular region. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.3 kDa |
AA Sequence : | MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHV IIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKT RDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQ SKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYA AVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | DHRSX dehydrogenase/reductase X-linked [ Homo sapiens (human) ] |
Official Symbol | DHRSX |
Synonyms | DHRSY; DHRS5X; DHRS5Y; DHRSXY; SDR7C6; CXorf11; SDR46C1 |
Gene ID | 207063 |
mRNA Refseq | NM_145177.3 |
Protein Refseq | NP_660160.2 |
MIM | 301034 |
UniProt ID | Q8N5I4 |
◆ Recombinant Proteins | ||
DHRSX-8191Z | Recombinant Zebrafish DHRSX | +Inquiry |
DHRSX-1749HFL | Recombinant Full Length Human DHRSX Protein, C-Flag-tagged | +Inquiry |
DHRSX-11980H | Recombinant Human DHRSX, GST-tagged | +Inquiry |
DHRSX-2604H | Recombinant Human DHRSX Protein, GST-tagged | +Inquiry |
Dhrsx-2553M | Recombinant Mouse Dhrsx Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHRSX-474HCL | Recombinant Human DHRSX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DHRSX Products
Required fields are marked with *
My Review for All DHRSX Products
Required fields are marked with *
0
Inquiry Basket