Recombinant Full Length Human DHRSX Protein, C-Flag-tagged

• Cat.No.: DHRSX-1749HFL
• Product Overview: Recombinant Full Length Human DHRSX Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: Predicted to enable oxidoreductase activity. Involved in positive regulation of autophagy. Located in extracellular region.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 36.3 kDa
• AA Sequence: MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHV IIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKT RDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQ SKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYA
  AVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Full Length: Full L.

Gene Information

• Gene Name: DHRSX dehydrogenase/reductase X-linked [ Homo sapiens (human) ]
• Official Symbol: DHRSX
• Synonyms: DHRSY; DHRS5X; DHRS5Y; DHRSXY; SDR7C6; CXorf11; SDR46C1
• Gene ID: 207063
• mRNA Refseq: NM_145177.3
• Protein Refseq: NP_660160.2
• MIM: 301034
• UniProt ID: Q8N5I4