Recombinant Human DHRSX Protein, GST-tagged

Cat.No. : DHRSX-2604H
Product Overview : Human DHRSX full-length ORF ( NP_660160.1, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : DHRSX (Dehydrogenase/Reductase X-Linked) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity and coenzyme binding. An important paralog of this gene is RDH14.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 62.9 kDa
AA Sequence : MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DHRSX dehydrogenase/reductase (SDR family) X-linked [ Homo sapiens ]
Official Symbol DHRSX
Synonyms DHRSX; dehydrogenase/reductase (SDR family) X-linked; dehydrogenase/reductase (SDR family) X chromosome; dehydrogenase/reductase SDR family member on chromosome X; dehydrogenase/reductase (SDR family) Y linked; DHRS5X; DHRS5Y; DHRSXY; DHRSY; SDR46C1; short chain dehydrogenase/reductase family 46C; member 1; dehydrogenase/reductase (SDR family) Y-linked; short chain dehydrogenase/reductase family 46C, member 1; CXorf11;
Gene ID 207063
mRNA Refseq NM_145177
Protein Refseq NP_660160
UniProt ID Q8N5I4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DHRSX Products

Required fields are marked with *

My Review for All DHRSX Products

Required fields are marked with *

0

Inquiry Basket

cartIcon