Recombinant Full Length Human DHRS4 Protein, GST-tagged

• Cat.No.: DHRS4-2539HF
• Product Overview: Human DHRS4 full-length ORF ( NP_066284.2, 1 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 278 amino acids
• Description: DHRS4 (Dehydrogenase/Reductase 4) is a Protein Coding gene. Among its related pathways are Signaling by Retinoic Acid and the visual cycle I (vertebrates). GO annotations related to this gene include receptor binding and oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor. An important paralog of this gene is DHRS4L2.
• Molecular Mass: 55.9 kDa
• AA Sequence: MHKAGLLGLCARAWNSVRMASSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSIMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDASYITGETVVVGGGTPSRL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DHRS4 dehydrogenase/reductase (SDR family) member 4 [ Homo sapiens ]
• Official Symbol: DHRS4
• Synonyms: DHRS4; dehydrogenase/reductase (SDR family) member 4; dehydrogenase/reductase SDR family member 4; FLJ11008; humNRDR; SCAD SRL; SDR SRL; SDR25C2; short chain dehydrogenase/reductase family 25C; member 2; NADP-dependent retinol dehydrogenase; peroxisomal short-chain alcohol dehydrogenase; NADPH-dependent retinol dehydrogenase/reductase; short-chain dehydrogenase/reductase family member 4; dehydrogenase/reductase (SDR family) member 4 like 2A; short chain dehydrogenase/reductase family 25C, member 1; short chain dehydrogenase/reductase family 25C, member 2; NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase; CR; NRDR; PHCR; PSCD; SDR-SRL; SDR25C1; SCAD-SRL
• Gene ID: 10901
• mRNA Refseq: NM_021004
• Protein Refseq: NP_066284
• MIM: 611596
• UniProt ID: Q9BTZ2