Recombinant Full Length Human DGUOK Protein, C-Flag-tagged
| Cat.No. : | DGUOK-2174HFL |
| Product Overview : | Recombinant Full Length Human DGUOK Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | In mammalian cells, the phosphorylation of purine deoxyribonucleosides is mediated predominantly by two deoxyribonucleoside kinases, cytosolic deoxycytidine kinase and mitochondrial deoxyguanosine kinase. The protein encoded by this gene is responsible for phosphorylation of purine deoxyribonucleosides in the mitochondrial matrix. In addition, this protein phosphorylates several purine deoxyribonucleoside analogs used in the treatment of lymphoproliferative disorders, and this phosphorylation is critical for the effectiveness of the analogs. Alternative splice variants encoding different protein isoforms have been described for this gene. |
| Source : | Mammalian cells |
| Species : | Human |
| Tag : | Flag |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 27.9 kDa |
| AA Sequence : | MAAGRLFLSRLRAPFSSMAKSPLEGVSSSRGLHAGRGPRRLSIEGNIAVGKSTFVKLLTKTYPEWHVATE PVATWQNIQAAGTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFPEKLLQARKPVQIF ERSVYSDRYIFAKNLFENGSLSDIEWHIYQDWHSFLLWEFASRITLHGFIYLQASPQVCLKRLYQRAREE EKGIELAYLEQLHGQHEAWLIHKTTKLHFEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNTFVKNL myc-FLAG tag |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome |
| Protein Pathways : | Metabolic pathways, Purine metabolism |
| Full Length : | Full L. |
| Gene Name | DGUOK deoxyguanosine kinase [ Homo sapiens (human) ] |
| Official Symbol | DGUOK |
| Synonyms | dGK; NCPH; NCPH1; PEOB4; MTDPS3 |
| Gene ID | 1716 |
| mRNA Refseq | NM_080916.3 |
| Protein Refseq | NP_550438.1 |
| MIM | 601465 |
| UniProt ID | Q16854 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DGUOK Products
Required fields are marked with *
My Review for All DGUOK Products
Required fields are marked with *
0
Inquiry Basket
