Recombinant Full Length Human DECR2 Protein, GST-tagged

Cat.No. : DECR2-2414HF
Product Overview : Human DECR2 full-length ORF ( NP_065715.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 292 amino acids
Description : DECR2 (2,4-Dienoyl-CoA Reductase 2) is a Protein Coding gene. Among its related pathways are Peroxisome and Metabolism. GO annotations related to this gene include receptor binding and 2,4-dienoyl-CoA reductase (NADPH) activity. An important paralog of this gene is PECR.
Molecular Mass : 57.2 kDa
AA Sequence : MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DECR2 2,4-dienoyl CoA reductase 2, peroxisomal [ Homo sapiens ]
Official Symbol DECR2
Synonyms DECR2; 2,4-dienoyl CoA reductase 2, peroxisomal; peroxisomal 2,4-dienoyl-CoA reductase; PDCR; SDR17C1; short chain dehydrogenase/reductase family 17C; member 1; 2,4-dienoyl-CoA reductase 2; short chain dehydrogenase/reductase family 17C, member 1;
Gene ID 26063
mRNA Refseq NM_020664
Protein Refseq NP_065715
MIM 615839
UniProt ID Q9NUI1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DECR2 Products

Required fields are marked with *

My Review for All DECR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon