Recombinant Full Length Human DECR2 Protein, GST-tagged

• Cat.No.: DECR2-2414HF
• Product Overview: Human DECR2 full-length ORF ( NP_065715.1, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 292 amino acids
• Description: DECR2 (2,4-Dienoyl-CoA Reductase 2) is a Protein Coding gene. Among its related pathways are Peroxisome and Metabolism. GO annotations related to this gene include receptor binding and 2,4-dienoyl-CoA reductase (NADPH) activity. An important paralog of this gene is PECR.
• Molecular Mass: 57.2 kDa
• AA Sequence: MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DECR2 2,4-dienoyl CoA reductase 2, peroxisomal [ Homo sapiens ]
• Official Symbol: DECR2
• Synonyms: DECR2; 2,4-dienoyl CoA reductase 2, peroxisomal; peroxisomal 2,4-dienoyl-CoA reductase; PDCR; SDR17C1; short chain dehydrogenase/reductase family 17C; member 1; 2,4-dienoyl-CoA reductase 2; short chain dehydrogenase/reductase family 17C, member 1
• Gene ID: 26063
• mRNA Refseq: NM_020664
• Protein Refseq: NP_065715
• MIM: 615839
• UniProt ID: Q9NUI1