Recombinant Full Length Human DCP1A Protein, GST-tagged

• Cat.No.: DCP1A-2888HF
• Product Overview: Human DCP1A full-length ORF ( AAH07439.1, 1 a.a. - 582 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2014]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 89.7 kDa
• Protein length: 582 amino acids
• AA Sequence: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPRQRSPLLNQPVPELSHASLIANQSPFRAPLNVTNTAGTSLPSVDLLQKLRLTPQHDQIQTQPLGKGAMVASFSPAAGQLATPESFIEPPSKTAAARVAASASLSNMVLAPLQSMQQNQDPEVFVQPKVLSSAIPVAGAPLVTATTTAVSSVLLAPSVFQQTVTRSSDLERKASSPSPLTIGTPESQRKPSIILSKSQLQDTLIHLIKNDSSFLSTLHEVYLQVLTKNKDNHNL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DCP1A DCP1 decapping enzyme homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: DCP1A
• Synonyms: DCP1A; DCP1 decapping enzyme homolog A (S. cerevisiae); mRNA-decapping enzyme 1A; HSA275986; SMAD4IP1; SMIF; decapping enzyme hDcp1a; transcription factor SMIF; putative protein product of Nbla00360; Smad4-interacting transcriptional co-activator; Nbla00360; FLJ21691
• Gene ID: 55802
• mRNA Refseq: NM_018403
• Protein Refseq: NP_060873
• MIM: 607010
• UniProt ID: Q9NPI6