Recombinant Full Length Human DAAM1 Protein, C-Flag-tagged
Cat.No. : | DAAM1-1134HFL |
Product Overview : | Recombinant Full Length Human DAAM1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Cell motility, adhesion, cytokinesis, and other functions of the cell cortex are mediated by reorganization of the actin cytoskeleton and several formin homology (FH) proteins have been associated with these processes. The protein encoded by this gene contains two FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. A key regulator of cytoskeletal architecture, the small GTPase Rho, is activated during development by Wnt/Fz signaling to control cell polarity and movement. The protein encoded by this gene is thought to function as a scaffolding protein for the Wnt-induced assembly of a disheveled (Dvl)-Rho complex. This protein also promotes the nucleation and elongation of new actin filaments and regulates cell growth through the stabilization of microtubules. Alternative splicing results in multiple transcript variants encoding distinct proteins. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 123.3 kDa |
AA Sequence : | MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKH REAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQLNSMAARKSLLALEKEEEEERSKTIESLKTA LRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSESINVIAQ SLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTA IMSFINAVLSQGAGVESLDFRLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRF ELVHIDTKSATQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKM KEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGG MLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTE IDDTKVFKILDLEDLERTFSAYQRQQDFFVNSNSKQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILL SRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHY QQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQRGNAYGFKISSL NKIADTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETEL EYQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHFGEEAGKIQPDEFFGIFDQFL QAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALRSGEVFDKDL SKLKRNRKRITNQMTDSSRERPITKLNFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | DAAM1 dishevelled associated activator of morphogenesis 1 [ Homo sapiens (human) ] |
Official Symbol | DAAM1 |
Synonyms | FLJ41657; KIAA0666 |
Gene ID | 23002 |
mRNA Refseq | NM_014992.2 |
Protein Refseq | NP_055807.1 |
MIM | 606626 |
UniProt ID | Q9Y4D1 |
◆ Recombinant Proteins | ||
ASTE1-1230HF | Recombinant Full Length Human ASTE1 Protein, GST-tagged | +Inquiry |
APOA5-787H | Recombinant Human APOA5 | +Inquiry |
ABCC1-1897C | Recombinant Chicken ABCC1 | +Inquiry |
SAMD3-3378H | Recombinant Human SAMD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MARCKSL1A-12351Z | Recombinant Zebrafish MARCKSL1A | +Inquiry |
◆ Native Proteins | ||
HBA1-8158H | Native Hemoglobin A1C (HbA1c) | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
MMP8-89H | Native Human Pro-MMP-8 | +Inquiry |
Proteoglycans-50B | Native Bovine Proteoglycans | +Inquiry |
Immunoglobulin D-79H | Native Human Immunoglobulin D | +Inquiry |
◆ Cell & Tissue Lysates | ||
Cerebellum-507D | Dog Cerebellum Lysate, Total Protein | +Inquiry |
SNRPE-1613HCL | Recombinant Human SNRPE 293 Cell Lysate | +Inquiry |
Adipose-483C | Chicken Adipose Tissues Lysate, Total Protein | +Inquiry |
NUP98-1235HCL | Recombinant Human NUP98 cell lysate | +Inquiry |
HSD3B1-5370HCL | Recombinant Human HSD3B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All DAAM1 Products
Required fields are marked with *
My Review for All DAAM1 Products
Required fields are marked with *
0
Inquiry Basket