Recombinant Full Length Human Cytomegalovirus G-Protein Coupled Receptor Homolog Us27(Us27) Protein, His-Tagged
Cat.No. : | RFL14723HF |
Product Overview : | Recombinant Full Length Human cytomegalovirus G-protein coupled receptor homolog US27(US27) Protein (P09703) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HHV5 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MTTSTNNQTLTQVSNMTNHTLNSTEIYQLFEYTRLGVWLMCIVGTFLNVLVITTILYYRR KKKSPSDTYICNLAVADLLIVVGLPFFLEYAKHHPKLSREVVCSGLNACFYICLFAGVCF LINLSMDRYCVIVWGVELNRVRNNKRATCWVVIFWILAVLMGMPHYLMYSHTNNECVGEF ANETSGWFPVFLNTKVNICGYLAPIALMAYTYNRMVRFIINYVGKWHMQTLHVLLVVVVS FASFWFPFNLALFLESIRLLAGVYNDTLQNVIIFCLYVGQFLAYVRACLNPGIYILVGTQ MRKDMWTTLRVFACCCVKQEIPYQDIDIELQKDIQRRAKHTKRTHYDRKNAPMESGEEEF LL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | US27 |
Synonyms | US27; G-protein coupled receptor homolog US27; HHRF2 |
UniProt ID | P09703 |
◆ Recombinant Proteins | ||
LRP6-2372R | Recombinant Rhesus Macaque LRP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPINK1-15H | Recombinant Human SPINK1 Protein, N-Met,N-His-tagged | +Inquiry |
LIMS1-29952TH | Recombinant Human LIMS1 | +Inquiry |
CA12-1456C | Recombinant Cynomolgus CA12 protein, His-tagged | +Inquiry |
CHST15-3225H | Recombinant Human CHST15 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
C4A-2H | Native Human Complement C4 | +Inquiry |
GOx-30A | Active Native Aspergillus Niger Glucose Oxidase | +Inquiry |
ACP-150P | Active Native Potato Acid Phosphatase | +Inquiry |
MUC1-376H | Active Native Human MUC1 | +Inquiry |
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDRG2-3930HCL | Recombinant Human NDRG2 293 Cell Lysate | +Inquiry |
LIPT1-4723HCL | Recombinant Human LIPT1 293 Cell Lysate | +Inquiry |
AASDH-1HCL | Recombinant Human AASDH cell lysate | +Inquiry |
RAD9A-2551HCL | Recombinant Human RAD9A 293 Cell Lysate | +Inquiry |
LRRK1-1035HCL | Recombinant Human LRRK1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All US27 Products
Required fields are marked with *
My Review for All US27 Products
Required fields are marked with *
0
Inquiry Basket