Recombinant Full Length Human Cytochrome P450 4F11(Cyp4F11) Protein, His-Tagged
Cat.No. : | RFL17054HF |
Product Overview : | Recombinant Full Length Human Cytochrome P450 4F11(CYP4F11) Protein (Q9HBI6) (1-524aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-524) |
Form : | Lyophilized powder |
AA Sequence : | MPQLSLSWLGLGPVAASPWLLLLLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWF WGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPK DMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQR LASEGSARLDMFEHISLMTLDSLQKCVFSFESNCQEKPSEYIAAILELSAFVEKRNQQIL LHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFID VLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQE LLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVC LINIIGIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKV VLALTLLHFRILPTHTEPRRKPELILRAEGGLWLRVEPLGANSQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP4F11 |
Synonyms | CYP4F11Cytochrome P450 4F11; CYPIVF11; EC 1.14.14.1; 3-hydroxy fatty acids omega-hydroxylase CYP4F11; Docosahexaenoic acid omega-hydroxylase; EC 1.14.14.79; Long-chain fatty acid omega-monooxygenase; EC 1.14.14.80; Phylloquinone omega-hydroxylase CYP4F11; |
UniProt ID | Q9HBI6 |
◆ Recombinant Proteins | ||
RFL19228PF | Recombinant Full Length Pasteurella Multocida Probable Oxaloacetate Decarboxylase Gamma Chain(Oadg) Protein, His-Tagged | +Inquiry |
MRGPRB13-3750R | Recombinant Rat MRGPRB13 Protein | +Inquiry |
FAM71F1-2975H | Recombinant Human FAM71F1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNFSF4-84M | Recombinant Mouse TNFSF4 Protein, His-tagged | +Inquiry |
DNAJA2-1657HFL | Recombinant Full Length Human DNAJA2 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
AFP-3018P | Native pig AFP | +Inquiry |
RPE-425 | Native Red algae RPE | +Inquiry |
PerCP-139 | Native Dinophyceae sp. Peridinin-chlorophyll-protein complex protein | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
GCT-007H | Native Human Gamma glutamyl transferases Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBA1A-662HCL | Recombinant Human TUBA1A 293 Cell Lysate | +Inquiry |
MAP4K3-4501HCL | Recombinant Human MAP4K3 293 Cell Lysate | +Inquiry |
FH-6227HCL | Recombinant Human FH 293 Cell Lysate | +Inquiry |
SOX21-1560HCL | Recombinant Human SOX21 293 Cell Lysate | +Inquiry |
HIF1AN-5564HCL | Recombinant Human HIF1AN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP4F11 Products
Required fields are marked with *
My Review for All CYP4F11 Products
Required fields are marked with *
0
Inquiry Basket