Recombinant Full Length Human Cytochrome P450 2U1(Cyp2U1) Protein, His-Tagged
Cat.No. : | RFL15545HF |
Product Overview : | Recombinant Full Length Human Cytochrome P450 2U1(CYP2U1) Protein (Q7Z449) (1-544aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-544) |
Form : | Lyophilized powder |
AA Sequence : | MSSPGPSQPPAEDPPWPARLLRAPLGLLRLDPSGGALLLCGLVALLGWSWLRRRRARGIP PGPTPWPLVGNFGHVLLPPFLRRRSWLSSRTRAAGIDPSVIGPQVLLAHLARVYGSIFSF FIGHYLVVVLSDFHSVREALVQQAEVFSDRPRVPLISIVTKEKGVVFAHYGPVWRQQRKF SHSTLRHFGLGKLSLEPKIIEEFKYVKAEMQKHGEDPFCPFSIISNAVSNIICSLCFGQR FDYTNSEFKKMLGFMSRGLEICLNSQVLLVNICPWLYYLPFGPFKELRQIEKDITSFLKK IIKDHQESLDRENPQDFIDMYLLHMEEERKNNSNSSFDEEYLFYIIGDLFIAGTDTTTNS LLWCLLYMSLNPDVQEKVHEEIERVIGANRAPSLTDKAQMPYTEATIMEVQRLTVVVPLA IPHMTSENTVLQGYTIPKGTLILPNLWSVHRDPAIWEKPEDFYPNRFLDDQGQLIKKETF IPFGIGKRVCMGEQLAKMELFLMFVSLMQSFAFALPEDSKKPLLTGRFGLTLAPHPFNIT ISRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CYP2U1 |
Synonyms | CYP2U1; Cytochrome P450 2U1; Long-chain fatty acid omega-monooxygenase |
UniProt ID | Q7Z449 |
◆ Recombinant Proteins | ||
MELA-2238B | Recombinant Bacillus subtilis MELA protein, His-tagged | +Inquiry |
ARSG-1172HF | Recombinant Full Length Human ARSG Protein, GST-tagged | +Inquiry |
ZC3H10-11825Z | Recombinant Zebrafish ZC3H10 | +Inquiry |
Dpp9-2645M | Recombinant Mouse Dpp9 Protein, Myc/DDK-tagged | +Inquiry |
RILPL2-7605M | Recombinant Mouse RILPL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
LEL/LEA-070TB | Native Tomato Lycopersicon esculentum Lectin (LEL/LEA) | +Inquiry |
S100AA-258B | Native Bovine S-100αα Protein | +Inquiry |
EGF-26462TH | Native Human EGF | +Inquiry |
AMBP-5312H | Native Human Alpha-1-Microglobulin/Bikunin Precursor | +Inquiry |
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
DYNLT1-6754HCL | Recombinant Human DYNLT1 293 Cell Lysate | +Inquiry |
GPA33-2122MCL | Recombinant Mouse GPA33 cell lysate | +Inquiry |
NP-001SCL | Recombinant SARS NP cell lysate | +Inquiry |
Daudi-018HCL | Human Daudi Whole Cell Lysate | +Inquiry |
SRR-1470HCL | Recombinant Human SRR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP2U1 Products
Required fields are marked with *
My Review for All CYP2U1 Products
Required fields are marked with *
0
Inquiry Basket